You have changed your country from to
. Please be aware that this will change the currency in the purchasing process.
Related products
- Proteins and Peptides
- Secondary antibodies
Reassurance, Refunds & Replacements
If your product does not perform as described on this datasheet, we will refund or replace your product...
Read our guarantee »This product is covered by the Abpromise guarantee. Our scientific support team are available to answer any questions or queries - fill out an inquiry form for ab8452 for help.
Alternatively, you can search the previous enquiries about this product to see if your query has already been answered.
|
|||||||||
 | |||||||||
|
|||||||||
In the western blot shown, you mentioned using sTie2 to precipitate. do you have a protocol for that?
|
|||||||||
ANSWER: |
Thank you for your enquiry. The Tie2 precipitation experiment was performed by an outside collaborator, and we do not have any further information at hand regarding this. I have tried to email the collaborator to see if we can obtain this information, as several customers have enquired about this. I see that one of my colleagues attempted previously and we did not receive a reply, so I am not optimistic about getting further information. If I do obtain the information you requested, I will forward it along to you. |
||||||||
|
|||||||||
How specific are these antibodies to mouse? How specific are they to 1 vs. 2 and vice versa? |
|||||||||
ANSWER: |
Thank you for your enquiry. ab8451 is specific for mouse Angiopoietin 1. ab8452 cross-reacts with human (reacts with Ang-2 and weakly with Ang-1) and mouse (specific for mAng-2). There is little sequence homology between the two epitopes of 1 versus 2, therefore, I do not expect either antibody to cross react with the other form. For example, ab8451 is specific for mouse Angiopoietin 1 and should not cross react with mouse Angiopoietin 2. Here is the clustalW alignment of the 2 epitopes: mouseAng2 MWQIIFLTFGWDLVLAS--AYSNFRKSVDSTGRRQYQVQNGP mouseAng1 --MTVFLSFAFFAAILTHIGCSNQRRNPENGGRRYNRIQHGQ :**:*.: .: : . ** *:. :. *** ::*:* I hope this information helps, please do not hesitate to contact us if you need any more advice or information, |
||||||||
|
|||||||||
On your website, there is a representative Western blot using the Ang2 ab (ab8452) performed by Marion Scharpfenecker. Do you have the protocol for this procedure? Why is there a band at 50KD? Is the antibody non-specific? Thank you. |
|||||||||
ANSWER: |
All the information available for this product is listed on the on-line datasheet (price, datasheet, publication, suitability, cross-reactivity). Angiopoietin-2 is a naturally occurring antagonist of angiopoietin-1. Western blot analysis showed that ANG2 is expressed as a homodimeric 68 kDa protein that is reduced to around 50 kD, after deglycosylation. We would refer you to the extensive “Resources (Popular Protocols)” section on the Abcam website, you may find useful information there. |
||||||||
|
|||||||||
Has this antibody been used for IHC on mouse paraffin sections? If so, at what concentration? What type of antigen retrieval is needed, if any? Please forward any pertinant protocol info. thnx. |
|||||||||
ANSWER: |
This antibody has never been tested in IHC on mouse tissue sections, therefore we can't guarantee results. |
||||||||
|
|||||||||
Does this antibody detect rat Ang-2 in western blotting? |
|||||||||
ANSWER: |
We have not tested this antibody for reactivity towards the rat ang-2. We would be very interested to hear the results. |
||||||||
|
|||||||||
| |||||||||
Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"
